old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 .
	MISGLNPTLRLFKDHKILYSNMERGLKPLLEVDNFINKYIQNKEGLEIYDKVVGKAAAVIIYNIGLQNVQAGVVSQPAKDFLESRGIKVAYKKLVEKINDRAESLIESLENPEEVYKYMIKRGIIVNNL
tmhmm (0)	---------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	---------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	---------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	XXXXX---------------------------------------------------------------------------------------------------------------------------X
psipred	-------EEEEEE--EEEEEE-----HHHHHHHHHHHH-HHHH---EEEEEHHHHHHHHHHHH--EEEEEHHHHHHHHHHHHHH----EEE-EE-----------------HHHHHHHHHHH-------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    21	    0.106
  max. Y    14	    0.126
  max. S    10	    0.207
  mean S     1-13   0.151
       D     1-13   0.136    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.136 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-129	alignment	1vk9A_201	1-147	0.8204	UNKNOWN FUNCTION

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
747491	Borrelia burgdorferi CA8	1 (0.46%)	3E-31	1-129	1-129	140	100	129	ref|NP_212563.1|	hypothetical protein BB_0429 [Borrelia burgdorferi B31] ref|...
498741	Borrelia sp. SV1	1 (0.46%)	1E-31	1-129	1-129	141	99	129	ref|WP_008882668.1|	hypothetical protein [Borrelia sp. SV1] gb|EEH00722.1| conse...
476212	Borrelia burgdorferi 94a	1 (0.46%)	5E-31	1-129	1-129	139	99	129	ref|WP_002661471.1|	hypothetical protein [Borrelia burgdorferi] gb|EEH00169.1| c...
521010	Borrelia bissettii DN127	1 (0.46%)	8E-31	1-129	1-129	138	99	129	ref|YP_004777669.1|	hypothetical protein BbiDN127_0432 [Borrelia bissettii DN127...
390236	Borrelia afzelii PKo	1 (0.46%)	5E-31	1-129	1-129	139	98	129	ref|YP_709874.1|	hypothetical protein BAPKO_0451 [Borrelia afzelii PKo] ref|Y...
498742	Borrelia spielmanii A14S	1 (0.46%)	6E-31	1-129	1-129	139	98	129	ref|WP_006433995.1|	hypothetical protein [Borrelia spielmanii] gb|EEF84372.1| co...
1234596	Borrelia garinii NMJW1	1 (0.46%)	2E-30	1-129	1-129	137	98	129	ref|YP_072872.1|	hypothetical protein BG0437 [Borrelia garinii PBi] ref|YP_00...
1239934	Borrelia afzelii HLJ01	1 (0.46%)	6E-31	1-129	1-129	139	97	129	ref|YP_006931603.1|	hypothetical protein BafHLJ01_0469 [Borrelia afzelii HLJ01] ...
412418	Borrelia recurrentis A1	1 (0.46%)	2E-31	1-129	1-129	140	90	129	ref|YP_002222889.1|	hypothetical protein BRE_431 [Borrelia recurrentis A1] ref|W...
314724	Borrelia turicatae 91E135	1 (0.46%)	1E-30	1-128	4-131	137	90	128	ref|YP_945427.1|	hypothetical protein BT0429 [Borrelia turicatae 91E135] ref|...
140	Borrelia hermsii	1 (0.46%)	5E-30	1-129	1-129	136	90	129	ref|YP_001883858.1|	hypothetical protein BH0429 [Borrelia hermsii HS1] ref|WP_01...
1293576	Borrelia hermsii YOR	1 (0.46%)	7E-30	1-129	3-131	135	90	129	gb|AHH13928.1|	Hypothetical protein BHW_0072400 [Borrelia hermsii MTW] gb|A...
1155096	Borrelia crocidurae str. Achema	1 (0.46%)	2E-31	1-129	1-129	141	89	129	ref|YP_002222078.1|	hypothetical protein BDU_427 [Borrelia duttonii Ly] ref|YP_0...
38876	Borrelia lonestari	1 (0.46%)	5E-30	1-128	1-128	136	86	128	gb|ABP88210.1|	hypothetical protein [Borrelia lonestari]
1302858	Borrelia miyamotoi LB-2001	1 (0.46%)	5E-30	1-128	1-128	136	86	128	ref|YP_008415576.1|	hypothetical protein I871_02260 [Borrelia miyamotoi LB-2001]...
1292392	Borrelia miyamotoi FR64b	1 (0.46%)	3E-30	1-128	1-128	136	85	128	gb|AHH04980.1|	Hypothetical protein BOM_0437 [Borrelia miyamotoi FR64b]
518637	Eubacterium biforme DSM 3989	1 (0.46%)	1E-20	9-112	6-106	104	34	104	ref|WP_003863905.1|	hypothetical protein [[Eubacterium] biforme] gb|EEC91314.1| ...
742726	Barnesiella intestinihominis YIT 11860	1 (0.46%)	1E-31	2-111	13-118	141	30	110	ref|WP_008862441.1|	TonB-dependent outer membrane receptor [Barnesiella intestin...
293826	Alkaliphilus metalliredigens QYMF	1 (0.46%)	2E-29	2-120	11-133	134	30	126	ref|YP_001319085.1|	hypothetical protein Amet_1218 [Alkaliphilus metalliredigens...
158190	Sphaerochaeta pleomorpha str. Grapes	1 (0.46%)	2E-28	6-129	11-134	131	30	124	ref|YP_005062818.1|	ATPase component of Mn/Zn ABC-type transporter [Sphaerochaet...