old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330
	MSRDTISIHFVNAALSGVKRLGMDVDTLLSHVGIEAELLHQPKARISPEQYTRFIKMLWMVTQDEHVGFDKQQRRLGTFAIMCQLIIHAKTLGDALELSSQFYKLFGDEWSVTLERDKHEARLVPLIPNAMDPDHFITESMLMIWHGLASWLIERRLPLERVHFSYPRPAHADEYDALFFAPVMQFDMPRTEITFAADYLDLPIRQNEETLEEFLKAAPAQLLVKFKNTNSLTSRIRDVLKSQIGEEMPTLNDVASMLYLSPQTLRRRLAAEGKSYQGVKDALRRDAAIHLLLNPDLTLEDVAQQVGFSETSTFHRAFKKWTGVTPGLYRQLHGYH
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (4%)	XXX----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXX
psipred	-----HHHHHHHHHHHHHHH----HHHHHHHH---HHHHH-------HHHHHHHHHHHHHHH------HHHH----HHHHHHHHHHH----HHHHHHHHHHHHHHH----EEEEEEE--EEEEEEE------HHHHHHHHHHHHHHHHHHHH-------HHHH--------HHHHHHH----EEE--HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH----HHHHHHHHHH---HHHHHHHHHH----HHHHHHHHHHHHHHHHHH-----HHHHHHHH----HHHHHHHHHHHH---HHHHHHH----

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    21	    0.123
  max. Y     4	    0.156
  max. S     1	    0.236
  mean S     1-3    0.223
       D     1-3    0.192    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.192 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-336	alignment	4fe7A_303	1-380	0.8108	DNA BINDING PROTEIN

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1144662	Acinetobacter sp. CIP 101966	2 (0.05%)	1E-100	1-336	1-336	372	100	336	ref|WP_005169495.1|	hypothetical protein [Acinetobacter] gb|ENW87208.1| hypothet...
1217668	Acinetobacter lwoffii NIPH 478	2 (0.05%)	1E-100	1-336	1-336	370	100	336	ref|WP_005106131.1|	hypothetical protein [Acinetobacter lwoffii] gb|ENW31971.1| ...
575588	Acinetobacter lwoffii SH145	4 (0.1%)	1E-101	1-336	11-346	376	99	336	ref|WP_004281704.1|	AraC family transcriptional regulator [Acinetobacter lwoffii...
1144673	Acinetobacter sp. CIP 64.7	3 (0.07%)	1E-100	1-336	1-336	372	99	336	ref|WP_004645946.1|	hypothetical protein [Acinetobacter] gb|ENU17637.1| hypothet...
981327	Acinetobacter lwoffii NCTC 5866 = CIP 64.10	2 (0.05%)	1E-100	1-336	1-336	371	99	336	ref|WP_005098008.1|	hypothetical protein [Acinetobacter lwoffii] gb|ENW23101.1| ...
1310605	Acinetobacter baumannii 348935	1 (0.03%)	1E-100	1-336	1-336	370	99	336	ref|WP_004785199.1|	hypothetical protein [Acinetobacter] gb|ENU98137.1| hypothet...
1217660	Acinetobacter indicus ANC 4215	2 (0.05%)	1E-99	1-336	13-348	369	97	336	ref|WP_005175790.1|	hypothetical protein [Acinetobacter] gb|ENW91116.1| hypothet...
1144661	Acinetobacter sp. CIP 101934	1 (0.03%)	1E-99	1-336	1-336	369	97	336	ref|WP_004814497.1|	AraC family transcriptional regulator [Acinetobacter] gb|EIM...
1147131	Acinetobacter nosocomialis 28F	1 (0.03%)	1E-102	1-336	50-385	377	96	336	ref|WP_006580334.1|	AraC family transcriptional regulator [Acinetobacter] gb|ERL...
1149135	Acinetobacter baumannii 107m	1 (0.03%)	1E-102	1-336	50-385	377	96	336	ref|YP_001712600.1|	AraC family transcriptional regulator [Acinetobacter baumann...
470	Acinetobacter baumannii	24 (0.6%)	1E-102	1-336	50-385	377	96	336	ref|WP_001277859.1|	AraC family transcriptional regulator [Acinetobacter baumann...
575585	Acinetobacter calcoaceticus RUH2202	18 (0.45%)	1E-102	1-336	50-385	377	96	336	ref|WP_003655243.1|	AraC family transcriptional regulator [Acinetobacter calcoac...
509170	Acinetobacter baumannii SDF	5 (0.12%)	1E-101	1-336	50-385	375	96	336	ref|YP_001706220.1|	AraC family transcriptional regulator [Acinetobacter baumann...
1147132	Acinetobacter pittii 42F	2 (0.05%)	1E-101	1-336	50-385	375	96	336	ref|YP_004996580.1|	two-component response regulator [Acinetobacter calcoaceticu...
48296	Acinetobacter pittii	2 (0.05%)	1E-101	1-336	50-385	374	96	336	ref|WP_017400277.1|	AraC family transcriptional regulator [Acinetobacter pittii]
981331	Acinetobacter calcoaceticus DSM 30006 = CIP 81.8	4 (0.1%)	1E-100	1-336	1-336	370	96	336	ref|WP_004638954.1|	hypothetical protein [Acinetobacter calcoaceticus] gb|ENU111...
1310914	Acinetobacter baumannii 25977_10	3 (0.07%)	1E-100	1-336	1-336	370	96	336	ref|WP_002051267.1|	AraC family transcriptional regulator [Acinetobacter] gb|EKF...
1311006	Acinetobacter baumannii 25681_2	8 (0.2%)	1E-100	1-336	1-336	370	96	336	ref|YP_001085859.1|	AraC family transcriptional regulator [Acinetobacter baumann...
1120929	Acinetobacter towneri DSM 14962 = CIP 107472	2 (0.05%)	1E-99	1-336	1-336	369	96	336	ref|WP_004972448.1|	hypothetical protein [Acinetobacter towneri] gb|ENV70343.1| ...
1310783	Acinetobacter baumannii 214216	3 (0.07%)	2E-99	1-336	1-336	369	96	336	gb|EXR83073.1|	bacterial regulatory helix-turn-helix s, AraC family protein...