old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180
	MDKFLIDVIVEIPKNSKIKYEYDRQTGQIRVDRILFGSESYPQNYGFIKNTLDWDGDELDCFIFADQPFLPATVVPTRIVGALEMIDDGEIDTKLLGVIDCDPRYKEINQISDLPKHRIEEILIFLKTYKLLQKKTVIIKGLKDVCWAKKEYEICLQLMKDYGHLSKDQFIQKMQILHPEHYQK
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (14%)	X--------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXXXXXX
psipred	----EEEEEEEE------EEEEE-----EEEEEE---------------HHH-------EEEEEE-------EEEEEEEEEEEEE--------EEEEEE-----HHH---HHH--HHHHHHHHHHHHHH-------EEE-----HHHHHHHHHHHHHHHHHH-----HHHHHHHHHH--HHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    47	    0.103
  max. Y    28	    0.110
  max. S    20	    0.161
  mean S     1-27   0.097
       D     1-27   0.104    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.104 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-184	alignment	1e9gA_202	1-284	0.8967	HYDROLASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.04%)	6E-56	1-184	1-184	222	100	184	ref|NP_073022.1|	inorganic pyrophosphatase [Mycoplasma genitalium G37] ref|YP...
662946	Mycoplasma genitalium M6282	1 (0.04%)	1E-55	1-184	1-184	221	99	184	ref|YP_006600387.1|	inorganic pyrophosphatase [Mycoplasma genitalium M6282] ref|...
1112856	Mycoplasma pneumoniae 309	1 (0.04%)	1E-56	1-184	1-184	224	82	184	ref|YP_005175769.1|	inorganic pyrophosphatase [Mycoplasma pneumoniae 309] ref|YP...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.04%)	2E-55	1-184	1-184	220	82	184	ref|NP_110216.1|	inorganic pyrophosphatase [Mycoplasma pneumoniae M129] ref|Y...
1048830	Mycoplasma iowae 695	1 (0.04%)	1E-56	6-184	3-181	224	64	179	ref|WP_004025160.1|	inorganic pyrophosphatase [Mycoplasma iowae] gb|EGZ31101.1| ...
272633	Mycoplasma penetrans HF-2	1 (0.04%)	6E-57	6-183	3-180	226	63	178	ref|NP_757826.1|	inorganic pyrophosphatase [Mycoplasma penetrans HF-2] ref|WP...
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.04%)	1E-54	6-184	3-181	217	59	179	ref|NP_078149.1|	inorganic pyrophosphatase [Ureaplasma parvum serovar 3 str. ...
708616	Mycoplasma gallisepticum str. F	1 (0.04%)	6E-55	8-184	9-185	219	58	177	ref|YP_005880832.1|	inorganic pyrophosphatase [Mycoplasma gallisepticum str. F] ...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.04%)	4E-55	6-184	3-181	219	58	179	ref|YP_002284713.1|	inorganic pyrophosphatase [Ureaplasma urealyticum serovar 10...
1006581	Mycoplasma gallisepticum S6	1 (0.04%)	3E-54	8-184	9-185	216	58	177	ref|YP_006581158.1|	inorganic pyrophosphatase [Mycoplasma gallisepticum VA94_799...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.04%)	3E-53	8-184	9-185	213	57	177	ref|NP_853057.2|	Inorganic pyrophosphatase [Mycoplasma gallisepticum str. R(l...
171287	Mycoplasma moatsii	1 (0.04%)	5E-53	1-183	1-184	212	52	184	ref|WP_022935579.1|	inorganic pyrophosphatase [Mycoplasma moatsii]
1188236	Mycoplasma arginini 7264	1 (0.04%)	4E-51	1-182	1-181	206	49	183	ref|WP_004414879.1|	Inorganic pyrophosphatase [Mycoplasma arginini] gb|ENY70002....
1034808	Mycoplasma anatis 1340	1 (0.04%)	1E-48	3-182	2-182	198	49	181	ref|WP_006886857.1|	inorganic pyrophosphatase [Mycoplasma anatis] gb|EGS28946.1|...
747682	Mycoplasma alligatoris A21JP2	1 (0.04%)	2E-52	3-184	2-184	210	48	183	ref|WP_005683458.1|	inorganic pyrophosphatase [Mycoplasma alligatoris] gb|EFF415...
512564	Mycoplasma crocodyli MP145	1 (0.04%)	4E-51	3-183	2-183	206	48	182	ref|YP_003559923.1|	inorganic diphosphatase [Mycoplasma crocodyli MP145] ref|WP_...
289397	Mycoplasma bovis PG45	1 (0.04%)	9E-51	4-183	3-183	205	48	181	ref|YP_004056450.1|	inorganic diphosphatase [Mycoplasma bovis PG45] ref|WP_01345...
767465	Mycoplasma bovis HB0801	1 (0.04%)	7E-51	4-183	3-183	205	48	181	ref|YP_004683248.1|	inorganic pyrophosphatase [Mycoplasma bovis Hubei-1] ref|YP_...
347257	Mycoplasma agalactiae PG2	1 (0.04%)	4E-50	4-183	3-183	203	48	181	ref|YP_001256336.1|	inorganic pyrophosphatase [Mycoplasma agalactiae PG2] ref|WP...
496833	Mycoplasma fermentans PG18	1 (0.04%)	6E-52	4-183	18-198	209	47	181	ref|YP_007762361.1|	hypothetical protein [Mycoplasma fermentans PG18] ref|WP_015...