old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340
	MIKRAITGIQASGRQHLGNFLGVMQGLKQLQSQYQLFLFVADLHAITVDFEPTMLKDNNLQLVKTLLALGLDYGKVNLFLQSDLMEHTMLGYLMLTQSNLGELQRMTQFKTKKLAQKRNSNNTITIPTGLLTYPVLMAADILLYQPDIVPVGNDQKQHLELTNDLAKRVAKKFKLKLKLPVFIENKDTNRIMDLSNPLKKMSKSNPDQNGVIYLDDSKETIIKKVRKATTDSFNKIRFAKKTQPGVTNLLVILTALLKEEVNHNLSKKIGSDLVKYYQNKSYLDLKNDLSSAVINVIESLKFKKAQITDEMVLKVLNDGKNQAKKVADETLKMFYKAFGLTSNQLFD
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (4%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (9%)	XX------------------------------------------------------------------------------------------------------------XXXXXXXXXXXX-----------------------------------------------------------------------XXXXXXXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------------------------X
psipred	---EEEEEE------HHHHHHHHHHHHHHH----EEEEEEE-EEEE-----HHHHHHHHHHHHHHHHHH------EEEEE------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------------EE----------------EEE-----HHHHHHHHHHHHH------------------HHHHHH------HHHH--------EEEE---HHHHHHHHH----------------------HHHHHHHH----HHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHH-HHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    46	    0.128
  max. Y     5	    0.138
  max. S    45	    0.224
  mean S     1-4    0.178
       D     1-4    0.160    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.160 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-347	alignment	5v0iB_201	1-326	0.8175	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
488339	synthetic Mycoplasma genitalium JCVI-1.0	1 (0.03%)	1E-95	1-347	1-347	356	100	347	ref|NP_072788.1|	tryptophanyl-tRNA synthetase [Mycoplasma genitalium G37] ref...
722438	Mycoplasma pneumoniae FH	1 (0.03%)	1E-93	2-342	1-341	349	69	341	ref|YP_005881289.1|	tryptophan--tRNA ligase [Mycoplasma pneumoniae FH] ref|WP_01...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	7E-84	1-341	1-349	317	46	351	ref|YP_005880536.1|	tryptophanyl-tRNA synthetase [Mycoplasma gallisepticum str. ...
146774	Callosobruchus chinensis	1 (0.03%)	5E-13	114-191	1-79	82	43	79	gb|ABU55334.1|	tryptophanyl-tRNA synthetase [Callosobruchus chinensis] gb|A...
649639	Bacillus cellulosilyticus DSM 2522	1 (0.03%)	1E-119	2-345	1-329	434	42	345	ref|YP_004095894.1|	tryptophanyl-tRNA synthetase [Bacillus cellulosilyticus DSM ...
1300222	Brevibacillus borstelensis AK1	1 (0.03%)	1E-118	2-342	1-327	430	42	342	ref|WP_003388062.1|	tryptophanyl-tRNA synthetase [Brevibacillus borstelensis] gb...
634997	Mycoplasma hyorhinis DBS 1050	1 (0.03%)	2E-92	1-340	1-327	345	42	340	ref|YP_005905138.1|	tryptophanyl-tRNA synthetase [Mycoplasma hyorhinis MCLD] ref...
872331	Mycoplasma hyorhinis HUB-1	1 (0.03%)	3E-92	1-340	1-327	344	42	340	ref|YP_003856593.1|	Tryptophanyl-trna synthetase protein [Mycoplasma hyorhinis H...
9598	Pan troglodytes	3 (0.08%)	7E-61	2-183	34-210	240	42	183	ref|NP_957715.1|	tryptophan--tRNA ligase, mitochondrial isoform 2 precursor [...
580331	Thermoanaerobacter italicus Ab9	1 (0.03%)	1E-126	2-341	1-324	456	41	340	ref|YP_003477072.1|	tryptophanyl-tRNA synthetase [Thermoanaerobacter italicus Ab...
583358	Thermoanaerobacter mathranii subsp. mathranii str. A3	1 (0.03%)	1E-125	2-341	1-324	454	41	340	ref|YP_003677023.1|	tryptophanyl-tRNA synthetase [Thermoanaerobacter mathranii s...
697303	Thermoanaerobacter wiegelii Rt8.B1	1 (0.03%)	1E-124	2-341	1-324	452	41	340	ref|YP_004820114.1|	tryptophanyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt...
273068	Thermoanaerobacter tengcongensis MB4	1 (0.03%)	1E-123	2-343	1-326	448	41	342	ref|NP_623071.1|	tryptophanyl-tRNA synthetase [Thermoanaerobacter tengcongens...
391606	Carboxydibrachium pacificum DSM 12653	2 (0.05%)	1E-122	3-343	4-328	445	41	341	ref|WP_009611059.1|	tryptophanyl-tRNA synthetase [Caldanaerobacter subterraneus]...
1131730	Bacillus vireti LMG 21834	1 (0.03%)	1E-122	2-345	1-329	445	41	345	ref|WP_024031034.1|	tryptophanyl-tRNA synthetase [Bacillus vireti] gb|ETI66091.1...
997346	Desmospora sp. 8437	1 (0.03%)	1E-119	2-343	16-342	434	41	343	ref|WP_009709451.1|	tryptophanyl-tRNA synthetase [Desmospora sp. 8437] gb|EGK126...
889513	Corynebacterium pseudotuberculosis I19	1 (0.03%)	1E-117	2-341	54-382	428	41	343	ref|YP_005682822.1|	tryptophanyl-tRNA synthetase [Corynebacterium pseudotubercul...
446462	Actinosynnema mirum DSM 43827	2 (0.05%)	1E-117	4-342	14-338	428	41	342	ref|YP_003104117.1|	tryptophanyl-tRNA synthetase [Actinosynnema mirum DSM 43827]...
1168865	Corynebacterium pseudotuberculosis 258	1 (0.03%)	1E-116	2-341	9-337	425	41	343	ref|YP_005374497.1|	trpS gene product [Corynebacterium pseudotuberculosis P54B96...
1161911	Corynebacterium pseudotuberculosis Cp162	1 (0.03%)	1E-116	2-341	27-355	425	41	343	ref|YP_003782866.1|	tryptophanyl-tRNA synthetase [Corynebacterium pseudotubercul...