old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410 . 420 . 430
	MAITDYCECRFTAGNGGNGIIAWKREAHYDKGGPGGGNGGNGGNVILQADHNCDSLFFLKNKKHLFAEDGQNGKPDLAHGKNGSDLLIKVPIGTTVKNLENNSVLVDFVHDKQSFILCFGGKGGKGNAAFKSPIMRAPNLYENGDKGEILNVSLEVKYLANVGIVGFPNSGKSTLISKLSNAKPKIANYRFTTLIPVLGVVKYQNNSLVFADIPGLIENASEGSGLGHDFLRHIERCEILIHLISLDPVDNDDPCKAYLQIMDELSKYSPLLVKKKMLVVANKIDVNEGEKRFKKLEKFLQKKSISVLKISALKKELGNLLDRVFELYNKTISQFGANKFSLPMELEKHYVFQNTNENNNDPLNIEKDSLNRWIVNCKRLRYWFDKIPQTTLDNIRRLGNKIKEIGIEDQLKSVGAKKGDIIFFDGCEFVIND
tmhmm (0)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (5%)	-------------------------------XXXXXXXXXXXXX---------------------------------------------------------------------------XXXXXXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	--------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	---EEEEEEEEEE------EE-----------------------EEEEE--------------EEE-------------------EEEEE-------------EE-----HHHHHHHHHHH----EEE--------------------EEEEEEEEE--------------HHHHHHHHH-----------EE----EEEEE-----EEEE--------------HHHHHHHHHHHH-EEEEEEE--------HHHHHHHHHHHHHH--HHHH----EEEEE------HHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH----EEEEE---------EEEEE----EEEEEEHHHHHHHH------HHHHHHHHHHHHH--HHHHHHH-------EEEE--EEEEEE-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    28	    0.141
  max. Y    28	    0.153
  max. S    27	    0.252
  mean S     1-27   0.124
       D     1-27   0.142    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.142 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-433	alignment	1udxA_201	1-412	0.9192	PROTEIN BINDING

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.03%)	1E-125	1-429	1-430	455	63	430	ref|YP_006581335.1|	GTPase ObgE [Mycoplasma gallisepticum VA94_7994-1-7P] ref|YP...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.03%)	1E-125	1-429	1-430	456	62	430	ref|NP_853232.2|	GTPase ObgE [Mycoplasma gallisepticum str. R(low)] ref|YP_00...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	1E-125	1-429	1-430	455	62	430	ref|YP_005880658.1|	GTPase ObgE [Mycoplasma gallisepticum str. F] ref|WP_0145745...
1048830	Mycoplasma iowae 695	1 (0.03%)	1E-103	1-429	1-423	382	51	429	ref|WP_004024754.1|	GTPase [Mycoplasma iowae] gb|EGZ31532.1| GTPase CgtA [Mycopl...
204536	Sulfurihydrogenibium azorense Az-Fu1	1 (0.03%)	1E-111	3-334	2-331	408	50	333	ref|YP_002728402.1|	GTPase ObgE [Sulfurihydrogenibium azorense Az-Fu1] ref|WP_01...
123214	Persephonella marina EX-H1	1 (0.03%)	1E-110	1-335	1-337	405	49	337	ref|YP_002730280.1|	GTPase ObgE [Persephonella marina EX-H1] ref|WP_012676423.1|...
436114	Sulfurihydrogenibium sp. YO3AOP1	3 (0.08%)	1E-110	3-335	2-336	404	49	335	ref|YP_001931045.1|	GTPase ObgE [Sulfurihydrogenibium sp. YO3AOP1] ref|WP_012459...
289376	Thermodesulfovibrio yellowstonii DSM 11347	2 (0.05%)	1E-111	1-331	1-333	409	48	333	ref|YP_002248280.1|	GTPase ObgE [Thermodesulfovibrio yellowstonii DSM 11347] ref...
432331	Sulfurihydrogenibium yellowstonense SS-5	1 (0.03%)	1E-109	3-342	2-343	401	47	342	ref|WP_007546733.1|	GTPase CgtA [Sulfurihydrogenibium yellowstonense] gb|EEP6064...
585161	Staphylococcus aureus subsp. aureus WW2703/97	1 (0.03%)	1E-100	3-287	2-287	372	46	286	ref|WP_000496096.1|	hypothetical protein, partial [Staphylococcus aureus] gb|EFB...
167555	Prochlorococcus marinus str. NATL1A	3 (0.08%)	2E-99	1-328	1-327	369	46	330	ref|YP_001014125.1|	GTPase ObgE [Prochlorococcus marinus str. NATL1A] ref|WP_011...
471881	Proteus penneri ATCC 35198	1 (0.03%)	7E-92	1-259	9-268	344	46	260	ref|WP_006535705.1|	GTPase [Proteus penneri] gb|EEG85238.1| Obg family GTPase Cg...
167546	Prochlorococcus marinus str. MIT 9301	2 (0.05%)	1E-90	1-310	1-308	340	46	311	ref|YP_001090463.1|	GTPase ObgE [Prochlorococcus marinus str. MIT 9301] ref|WP_0...
93058	Prochlorococcus marinus str. MIT 9202	1 (0.03%)	1E-90	1-310	1-308	340	46	311	ref|WP_002805602.1|	GTPase CgtA [Prochlorococcus marinus] gb|EEE39595.1| GTP-bin...
146891	Prochlorococcus marinus str. AS9601	2 (0.05%)	3E-90	1-310	1-308	339	46	311	ref|YP_001008633.1|	GTPase ObgE [Prochlorococcus marinus str. AS9601] ref|WP_011...
93060	Prochlorococcus marinus str. MIT 9215	2 (0.05%)	4E-90	1-310	1-308	338	46	311	ref|YP_001483443.1|	GTPase ObgE [Prochlorococcus marinus str. MIT 9215] ref|WP_0...
4577	Zea mays	4 (0.1%)	4E-71	1-241	290-531	275	46	242	ref|NP_001168346.1|	uncharacterized protein LOC100382114 [Zea mays] gb|ACN27906....
868864	Desulfurobacterium thermolithotrophum DSM 11699	1 (0.03%)	1E-111	2-334	3-335	410	45	334	ref|YP_004280983.1|	GTPase obg [Desulfurobacterium thermolithotrophum DSM 11699]...
638303	Thermocrinis albus DSM 14484	1 (0.03%)	1E-105	3-328	2-329	390	45	328	ref|YP_003473435.1|	GTP-binding protein Obg/CgtA [Thermocrinis albus DSM 14484] ...
313612	Lyngbya sp. PCC 8106	3 (0.08%)	1E-103	1-331	1-332	382	45	335	ref|WP_009787056.1|	GTPase CgtA [Lyngbya sp. PCC 8106] gb|EAW34341.1| Small GTP-...