old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 .
	MATIRIQTDDFDLNAEVAALRARNPKIGALACFVGTVRDLNEGDSVAAMELEHYPGMTEKALEKIAAEAGRRWPGIDVAIVHRVGRLLPLDQIVMVATVASHRGDAFASCEFVMDYLKTEAPFWKKETTPDGERWVDARSTDDAALARWGVESGNTPR
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (11%)	X---------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXX
psipred	--EEEEEE----HHHHHHHHH-------EEEEEEEEE--------EEEEEEEE--HHHHHHHHHHHHHHHHH----EEEEEEE--------EEEEEEEE---HHHHHHHHHHHHHHHHH---EEEEEE-----EEE------HHHHHH----------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    48	    0.161
  max. Y    48	    0.157
  max. S    28	    0.241
  mean S     1-47   0.122
       D     1-47   0.144    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.144 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-158	alignment	1fm0E_201	1-142	0.8249	TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
398577	Burkholderia ambifaria MC40-6	2 (0.08%)	5E-59	1-158	1-158	232	100	158	ref|YP_001808461.1|	molybdopterin biosynthesis MoaE protein [Burkholderia ambifa...
396596	Burkholderia ambifaria IOP40-10	2 (0.08%)	1E-58	1-158	1-158	231	99	158	ref|WP_006755405.1|	molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
331272	Burkholderia cenocepacia HI2424	1 (0.04%)	1E-58	1-158	1-158	231	98	158	ref|YP_626066.1|	molybdopterin biosynthesis MoaE [Burkholderia cenocepacia AU...
339670	Burkholderia ambifaria AMMD	1 (0.04%)	2E-57	1-158	1-158	227	98	158	ref|YP_773678.1|	molybdopterin biosynthesis MoaE [Burkholderia ambifaria AMMD...
1009846	Burkholderia cepacia GG4	1 (0.04%)	3E-59	1-158	1-158	233	97	158	ref|YP_006615693.1|	molybdopterin biosynthesis protein MoaE [Burkholderia cepaci...
396597	Burkholderia ambifaria MEX-5	2 (0.08%)	2E-58	1-158	1-158	230	97	158	ref|WP_006758353.1|	molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
1335308	Burkholderia vietnamiensis AU4i	2 (0.08%)	1E-57	1-158	1-158	228	97	158	ref|WP_021156501.1|	Molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
1055524	Burkholderia cenocepacia H111	2 (0.08%)	2E-57	1-158	1-158	227	97	158	ref|YP_002231050.1|	molybdopterin converting factor subunit 2 [Burkholderia ceno...
350702	Burkholderia cenocepacia PC184	2 (0.08%)	2E-57	1-158	1-158	227	97	158	ref|WP_006478643.1|	molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
95486	Burkholderia cenocepacia	1 (0.04%)	2E-57	1-158	1-158	227	97	158	ref|WP_023476849.1|	Molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
482957	Burkholderia lata	2 (0.08%)	1E-57	1-158	1-158	228	96	158	ref|YP_369389.1|	molybdopterin synthase subunit MoaE [Burkholderia lata] ref|...
406425	Burkholderia cenocepacia MC0-3	2 (0.08%)	2E-57	1-158	1-158	227	96	158	ref|YP_001765157.1|	molybdopterin biosynthesis MoaE protein [Burkholderia cenoce...
416344	Burkholderia sp. KJ006	1 (0.04%)	1E-58	1-158	1-158	231	94	158	ref|YP_001119616.1|	molybdopterin synthase subunit MoaE [Burkholderia vietnamien...
987057	Burkholderia sp. TJI49	2 (0.08%)	8E-58	1-158	1-158	228	94	158	gb|EGC98944.1|	molybdopterin synthase subunit MoaE [Burkholderia sp. TJI49]
513051	Burkholderia multivorans CGD1	2 (0.08%)	2E-57	1-158	1-158	227	92	158	ref|WP_006402319.1|	molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
101571	Burkholderia ubonensis	2 (0.08%)	6E-59	1-158	1-158	232	91	158	ref|WP_010092215.1|	molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
985078	Burkholderia multivorans CF2	2 (0.08%)	2E-57	1-158	2-159	227	91	158	ref|WP_006415335.1|	molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
395019	Burkholderia multivorans ATCC 17616	2 (0.08%)	3E-57	1-158	1-158	226	91	158	ref|YP_001579608.1|	molybdopterin biosynthesis MoaE protein [Burkholderia multiv...
985079	Burkholderia multivorans ATCC BAA-247	2 (0.08%)	4E-57	1-158	1-158	226	91	158	ref|WP_006407806.1|	molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
350701	Burkholderia dolosa AUO158	1 (0.04%)	8E-57	1-158	1-158	224	91	158	ref|WP_006764182.1|	molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...