old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340
	MLNICQNLSSVAKPDLIVVSGHKCNIQRGPQTSIGTPTITKRVTAWEALIYLEMLLAEDEAFAILATFVPPLVALLPPENFASDNWVYVHDPASRPLLKSIFAQLKQMSADTHGYNEVMDTTRWEIILVDVTATFHKPCVLDIKLGYVRHSPHTLPDKVERIHKRQLRRSQPIRFCGAHHQFCRQNNDIGECFELEEFTKDMGYALETEESHRRALRSFFTTASLMTTSNTNETTIIDDRHAMARSRCCRQRVQKLVDFLKGHLGQMLLERIAFVSASLLIVYDATGCCGRNVTVSEGINSMNDMVNVYLIDFSRSGDRRLHFPEEVVGFVQGLEKIIFLLS
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (19%)	XX--XXXXXXXXX-------------------------------------------------------------------------------------------XXXXXXXXXXXXX----------------------------------XXXXXXXXXXXXXXXXXXXXX------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXX-------------------------------------
psipred	--HHHHH---------EEE---HHHHH----------EEE----HHHHHHHHHHHH----HHHH-------EEEE--HHH------EEE--------HHHHHHHH-----------------EEEEEEHHHH------EEEEEEE----------HHHHHHHHHHHH-----EEEE--EEEEE---------EEEEE--HHH-EE---HHHHHHHHHHHHH---------------HHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHH---EEE--EEEEE-----------------------EEEE-----------------HHHHHHHHHHHHHH-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    46	    0.141
  max. Y    13	    0.188
  max. S    11	    0.393
  mean S     1-12   0.339
       D     1-12   0.247    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.247 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-342	alignment	2aqxA_202	1-289	0.5295	TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
999953	Trypanosoma brucei brucei strain 927/4 GUTat10.1	2 (0.12%)	1E-101	1-342	1-342	375	100	342	ref|XP_827490.1|	hypothetical protein [Trypanosoma brucei brucei strain 927/4...
679716	Trypanosoma brucei gambiense DAL972	2 (0.12%)	1E-101	1-342	1-342	376	99	342	emb|CBH14688.1|	hypothetical protein, conserved [Trypanosoma brucei gambiens...
1068625	Trypanosoma congolense IL3000	3 (0.18%)	4E-78	1-341	1-340	298	47	348	emb|CCD15714.1|	unnamed protein product [Trypanosoma congolense IL3000]
5693	Trypanosoma cruzi	4 (0.24%)	2E-89	5-342	4-334	336	46	338	gb|EKG03133.1|	hypothetical protein TCSYLVIO_005831 [Trypanosoma cruzi]
0	UNIDENTIFIED	58 (3.44%)	4E-89	5-342	4-334	334	45	338	gb|ESS71139.1|	hypothetical protein TCDM_00180 [Trypanosoma cruzi Dm28c]
85056	Trypanosoma cruzi marinkellei	2 (0.12%)	9E-87	5-342	61-391	326	44	338	gb|EKF31703.1|	hypothetical protein MOQ_004458 [Trypanosoma cruzi marinkell...
1055687	Trypanosoma vivax Y486	2 (0.12%)	1E-83	4-341	49-376	316	42	338	emb|CCC50776.1|	conserved hypothetical protein [Trypanosoma vivax Y486]
420245	Leishmania braziliensis MHOM/BR/75/M2904	2 (0.12%)	4E-82	8-342	1-375	311	30	389	ref|XP_001568411.1|	conserved hypothetical protein [Leishmania braziliensis MHOM...
929439	Leishmania mexicana MHOM/GT/2001/U1103	2 (0.12%)	6E-81	8-342	1-375	307	30	389	ref|XP_003879310.1|	conserved hypothetical protein [Leishmania mexicana MHOM/GT/...
435258	Leishmania infantum JPCM5	2 (0.12%)	4E-81	8-342	1-375	308	29	389	ref|XP_001469124.1|	conserved hypothetical protein [Leishmania infantum JPCM5] e...
5661	Leishmania donovani	2 (0.12%)	5E-81	8-342	1-375	307	29	389	ref|XP_003864898.1|	hypothetical protein, conserved [Leishmania donovani] emb|CB...
347515	Leishmania major strain Friedlin	2 (0.12%)	8E-81	8-342	1-375	307	29	389	ref|XP_003722708.1|	conserved hypothetical protein [Leishmania major strain Frie...
134013	Phytomonas sp. isolate Hart1	1 (0.06%)	5E-67	18-342	8-366	261	28	374	emb|CCW69486.1|	unnamed protein product [Phytomonas sp. isolate Hart1]
134006	Phytomonas sp. isolate EM1	1 (0.06%)	6E-67	19-342	8-366	261	28	374	emb|CCW62150.1|	unnamed protein product [Phytomonas sp. isolate EM1]
28005	Strigomonas culicis	2 (0.12%)	2E-67	20-341	9-407	262	26	408	gb|EPY25695.1|	hypothetical protein STCU_06548 [Strigomonas culicis]
59799	Angomonas deanei	3 (0.18%)	2E-55	19-334	8-362	222	26	372	gb|EPY38664.1|	hypothetical protein AGDE_05265 [Angomonas deanei]
99883	Tetraodon nigroviridis	8 (0.47%)	3E-58	125-342	204-395	232	23	226	emb|CAG06789.1|	unnamed protein product [Tetraodon nigroviridis]
914234	Ceriporiopsis subvermispora B	3 (0.18%)	2E-52	10-341	2-319	212	23	351	gb|EMD34281.1|	hypothetical protein CERSUDRAFT_117162 [Ceriporiopsis subver...
1124627	Dekkera bruxellensis AWRI1499	1 (0.06%)	3E-12	79-165	62-147	79	23	87	gb|EIF46374.1|	inositol hexaphosphate kinase [Dekkera bruxellensis AWRI1499...
7739	Branchiostoma floridae	4 (0.24%)	2E-51	130-341	239-429	209	22	223	ref|XP_002600752.1|	hypothetical protein BRAFLDRAFT_123507 [Branchiostoma florid...